SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021481090.1.32639 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021481090.1.32639
Domain Number 1 Region: 14-115
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 1.02e-29
Family Nucleoplasmin-like core domain 0.0000747
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021481090.1.32639
Sequence length 141
Comment nucleoplasmin-like [Oncorhynchus mykiss]; AA=GCF_002163495.1; RF=representative genome; TAX=8022; STAX=8022; NAME=Oncorhynchus mykiss; AL=Chromosome; RT=Major
Sequence
MDLSLSPSVSDTVCVLWGCELNDTQRKAVFEIAEDLLEHQFFIRTMCLSAEASKEMHVVE
VQDRVGECCKPVPIATLHPMCQPMVSFSGFELIPPVIFNLRSGQGPLFISGQHLTLVYEE
EEEEKEEVFSSTPPLDHSVLQ
Download sequence
Identical sequences A0A060XBE1
XP_021481087.1.32639 XP_021481088.1.32639 XP_021481089.1.32639 XP_021481090.1.32639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]