SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021527903.1.9421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021527903.1.9421
Domain Number 1 Region: 12-114
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 1.12e-37
Family Nucleoplasmin-like core domain 0.00000796
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021527903.1.9421
Sequence length 291
Comment LOW QUALITY PROTEIN: nucleophosmin [Aotus nancymaae]; AA=GCF_000952055.2; RF=representative genome; TAX=37293; STAX=37293; NAME=Aotus nancymaae; AL=Scaffold; RT=Major
Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTFPWGFEITPPXVLRLKCGSGPVHISGTALSTVEE
DAESEDEEEEDVKLLMSGKRSAPGGGSKVPQKKVKLATDEDDDDEDDDDDDEDDDDDDFD
DEETEEKVPVKKSIRDTPAKNAQKSNQNGKDSKPSTPRSKGQESFKKQEKTPKTPKGPSS
VEDIKAKMQASIEKGGSLPKVEAKFVNYVKNCFRMTDQEAIQDLWQWRKSL
Download sequence
Identical sequences XP_021527903.1.9421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]