SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021695575.1.48696 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021695575.1.48696
Domain Number 1 Region: 472-685
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-54
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 155-273
Classification Level Classification E-value
Superfamily BRCT domain 1.61e-19
Family DNA-repair protein XRCC1 0.065
Further Details:      
 
Domain Number 3 Region: 291-369
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000017
Family DNA topoisomerase II binding protein 1, TopBP1 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_021695575.1.48696
Sequence length 965
Comment protein ECT2 isoform X3 [Aedes aegypti]; AA=GCF_002204515.2; RF=na; TAX=7159; STAX=7159; NAME=Aedes aegypti; strain=LVP_AGWG; AL=Chromosome; RT=Major
Sequence
MKELANLDKKKLPPDSQHQHRVQGNQKLLESCNGSSGSRAEHKSWTIPQKTDIGAIVKTN
TIIVAKTEQPLHSIENRNSTTAKMDHSTCDKSKTEAMSISPPPSREQVRICLVGAVAHDK
ACLAAAQTLKLPLVLSETGAEYATDTNTLTYFVLNQFDGPIYDTIYRSKHRILGPPALQQ
AARGGDGIPHNNRPIYNYCMRGVITCFTGIRKKDELTRLVDLIHSMGGSIRKDMNTKVTH
LICNTTGGEKYQYAMTFRLAVVRPSWVVQAWQNRNDPNFTANVEEFTKSHRLKAFEGQKI
CFFGFPPEEHQHMVDVLKMNGGIPADLEDPECSHVVVDEHVVTSKPEPKNTKTHIVKADW
FWYTIQNGYADEGYYLFGDYLDSIANTPGVDRRDSLPISFNKRKRKRLSHRTPAGEGTPL
GAGKRRSSVSDAGLLSVSGSFLDCTTSPDKHEGSKKNAIAEAADASIDQPIKSQSMRHNH
FMDFFHTESNYVGILDTIVNLFKVPLEEMAENDPENALLNKSELKSIFSNFLPIHDVHKE
MLNQLKEIHNKWAEEHLIGQIILDYRDDLIKAYPPYVNFFEQMKETLLQCDASNPRFHAF
LKINQAKPECGRQTLQDLMIRPVQRLPSISLLLNDILKHTAKSNPDHKKLDEALKAIKEV
MTYINEDKRKTEGQLAMFDIFNDIDNCPPHLVSSHRHFVSRCEVTELTDSLSGRGDSLML
FLFSDTLEVCKKRSRAFNNTKSPSTNGLNSTRCQTTKPYKHVKLMPLSSIRLVVNIQDSP
RAFALNCRATADNKDRLHSFSICDEEKDKIVYLKSLCKQLAENACKADADKFMLNCESEE
LGIDVSDINVGTLSKAFKFATRTRLRVGRAFSFNKTPSKLKRAVSTMMTSPFGSTQSLTP
ASQLAQMKLASCTNINEVGEESSETDSKASSSPSSASEILVAPMSVQPTRKNKNPPMSMA
ALRRF
Download sequence
Identical sequences XP_021695575.1.48696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]