SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_022068480.1.10920 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_022068480.1.10920
Domain Number 1 Region: 5-116
Classification Level Classification E-value
Superfamily SRP19 3.01e-38
Family SRP19 0.00000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_022068480.1.10920
Sequence length 141
Comment signal recognition particle 19 kDa protein isoform X1 [Acanthochromis polyacanthus]; AA=GCF_002109545.1; RF=representative genome; TAX=80966; STAX=80966; NAME=Acanthochromis polyacanthus; ecotype=Palm Islands; AL=Scaffold; RT=Major
Sequence
MAHLTQNPADKERFICVYPIYINSKKTLAEGRRIPTEKAVENPSCAEIRDVLTAAGMNVY
VENKMHPREWNRDVQFRGRVRVQMKQADGSLCQEKFTSRKDVMFYVAEMIPKLKTRTQKG
GGSDTSSQQGEGGKKSKKKKK
Download sequence
Identical sequences XP_022068480.1.10920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]