SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YP_003611043.1.53031 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YP_003611043.1.53031
Domain Number - Region: 106-173
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 0.0129
Family PA2201 N-terminal domain-like 0.0057
Further Details:      
 
Domain Number - Region: 295-328
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0657
Family Myb/SANT domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YP_003611043.1.53031
Sequence length 329
Comment hypothetical protein ECL_00528 [Enterobacter cloacae subsp. cloacae ATCC 13047]; AA=GCF_000025565.1; RF=reference genome; TAX=716541; STAX=550; NAME=Enterobacter cloacae subsp. cloacae ATCC 13047; strain=ATCC 13047; AL=Complete Genome; RT=Major
Sequence
MKHLNMTSLLARIALERDDELLQLTAAMSDGKKTSGNPMAIRFKPAVGDFIILMSGRLGI
SAAALVNIMIEGVMRETLTPHQAAVTRIPERFWLLMDEYNLSSPEVAHLLADWNMSLGVL
ENRERTLGYMTPPLLEKLSEWFYVSTGWLSGKIVPPVRITVFPDWLDASRLLTCRIQEIN
PEDFIARPDLFFIRKKEQDDIFLFIRRYTTINDTRFRVVECAGRCSVSGESGKQFTLFLA
LCGLLFKAEVLSLVDTFIDSGNILDSMISGEVLPPAALREIQKPFHDSHGKYTQRIWSTE
EREPFLNPDNFINDEWRKIAEDIISTRSI
Download sequence
Identical sequences A0A0H3CEQ9 A0A0M7JBH7 A0A1D8JMR5 A0A243TJK7 A0A2D2ECX3
WP_013095249.1.25156 WP_013095249.1.40358 WP_013095249.1.50574 WP_013095249.1.55189 WP_013095249.1.75060 WP_013095249.1.92861 YP_003611043.1.53031 gi|296100897|ref|YP_003611043.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]