SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_000368.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_000368.1.92137
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 2e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000339
Further Details:      
 
Domain Number 2 Region: 242-371
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 7.19e-31
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 430-490
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000123
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_000368.1.92137
Sequence length 502
Comment wiskott-Aldrich syndrome protein [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLH
PGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPP
PPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALV
PAGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSRA
IHSSDEGEDQAGDEDEDDEWDD
Download sequence
Identical sequences A0A024QYX8 P42768
ENSP00000365891 ENSP00000469374 HR4612 9606.ENSP00000365891 ENSP00000410537 NP_000368.1.87134 NP_000368.1.92137 ENSP00000365891 gi|4507909|ref|NP_000368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]