SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_000413.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_000413.1.87134
Domain Number 1 Region: 312-390
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.66e-26
Family Intermediate filament protein, coiled coil region 0.00077
Further Details:      
 
Domain Number 2 Region: 82-116
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000293
Family Intermediate filament protein, coiled coil region 0.0024
Further Details:      
 
Domain Number 3 Region: 194-310
Classification Level Classification E-value
Superfamily Prefoldin 0.00000366
Family Prefoldin 0.009
Further Details:      
 
Weak hits

Sequence:  NP_000413.1.87134
Domain Number - Region: 133-225
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_000413.1.87134
Sequence length 432
Comment keratin, type I cytoskeletal 17 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSC
YSFGSGGGYGSSFGGVDGLLAGGEKATMQNLNDRLASYLDKVRALEEANTELEVKIRDWY
QRQAPGPARDYSQYYRTIEELQNKILTATVDNANILLQIDNARLAADDFRTKFETEQALR
LSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLKKNHEEEMNALRGQVGGEINVE
MDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEI
SELRRTMQALEIELQSQLSMKASLEGNLAETENRYCVQLSQIQGLIGSVEEQLAQLRCEM
EQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKV
ISSREQVHQTTR
Download sequence
Identical sequences Q04695
ENSP00000308452 ENSP00000308452 NP_000413.1.87134 NP_000413.1.92137 gi|4557701|ref|NP_000413.1| ENSP00000308452 9606.ENSP00000308452 HR6445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]