SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_000868.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_000868.1.87134
Domain Number 1 Region: 380-543
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 9.42e-24
Family Toll/Interleukin receptor TIR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 225-328
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000107
Family I set domains 0.00000221
Further Details:      
 
Domain Number 3 Region: 137-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000134
Family I set domains 0.0000137
Further Details:      
 
Domain Number 4 Region: 44-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000115
Family I set domains 0.0000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_000868.1.87134
Sequence length 569
Comment interleukin-1 receptor type 1 isoform 1 precursor [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKD
DSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNL
CYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDR
LIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDL
GSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISE
IESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIVCSVFIYKIFK
IDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCG
YKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQ
DGIKVVLLELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPV
QRRSPSSKHQLLSPATKEKLQREAHVPLG
Download sequence
Identical sequences P14778
gi|4504659|ref|NP_000868.1| NP_000868.1.87134 NP_000868.1.92137 NP_001307907.1.87134 NP_001307907.1.92137 NP_001307909.1.87134 NP_001307909.1.92137 NP_001307910.1.87134 NP_001307910.1.92137 NP_001307911.1.87134 NP_001307911.1.92137 XP_005263987.1.92137 XP_005263991.1.92137 XP_011509417.1.92137 XP_011509418.1.92137 XP_011509419.1.92137 XP_011509420.1.92137 XP_016859478.1.92137 ENSP00000233946 ENSP00000386380 9606.ENSP00000233946 ENSP00000393296 NYSGRC-IgSF-IL1R1_HUMAN ENSP00000386380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]