SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001001579.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001001579.1.92137
Domain Number 1 Region: 51-360
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 8.2e-120
Family PDEase 0.0000000000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001001579.1.92137
Sequence length 386
Comment high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A isoform g [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPETIEALRKPTFDVWLWE
PNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSM
VWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCA
VAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNE
EHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKV
TKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAMKELQKKT
DSLTSGATEKSRERSRDVKNSEGDCA
Download sequence
Identical sequences gi|48762728|ref|NP_001001572.1| gi|48762730|ref|NP_001001573.1| gi|48762742|ref|NP_001001579.1| gi|48762752|ref|NP_001001584.1| gi|48762754|ref|NP_001001585.1| NP_001001572.1.87134 NP_001001572.1.92137 NP_001001573.1.87134 NP_001001573.1.92137 NP_001001579.1.87134 NP_001001579.1.92137 NP_001001584.1.87134 NP_001001584.1.92137 NP_001001585.1.87134 NP_001001585.1.92137 XP_016883855.1.92137 XP_018873434.1.27298 XP_018873435.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]