SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001002827.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001002827.1.4139
Domain Number 1 Region: 1573-1813
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.39e-53
Family Ankyrin repeat 0.00000103
Further Details:      
 
Domain Number 2 Region: 510-552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000307
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 3 Region: 548-588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000042
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 4 Region: 472-514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000584
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 5 Region: 352-477
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000267
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 765-803
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000292
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 924-1048
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000314
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 8 Region: 586-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000597
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 9 Region: 155-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000746
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 10 Region: 191-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 11 Region: 274-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000138
Family EGF-type module 0.013
Further Details:      
 
Domain Number 12 Region: 807-931
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000204
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 13 Region: 688-726
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000274
Family EGF-type module 0.019
Further Details:      
 
Domain Number 14 Region: 234-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000341
Family EGF-type module 0.033
Further Details:      
 
Domain Number 15 Region: 727-770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family EGF-type module 0.021
Further Details:      
 
Domain Number 16 Region: 1249-1280
Classification Level Classification E-value
Superfamily Notch domain 0.000000248
Family Notch domain 0.0021
Further Details:      
 
Domain Number 17 Region: 311-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000675
Family EGF-type module 0.011
Further Details:      
 
Domain Number 18 Region: 1039-1082
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000712
Family EGF-type module 0.011
Further Details:      
 
Domain Number 19 Region: 1211-1242
Classification Level Classification E-value
Superfamily Notch domain 0.00000523
Family Notch domain 0.0065
Further Details:      
 
Domain Number 20 Region: 118-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000614
Family EGF-type module 0.035
Further Details:      
 
Domain Number 21 Region: 29-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000118
Family EGF-type module 0.028
Further Details:      
 
Domain Number 22 Region: 63-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000017
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  NP_001002827.1.4139
Domain Number - Region: 1130-1168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000161
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 1085-1122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00053
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 1172-1200
Classification Level Classification E-value
Superfamily Notch domain 0.0157
Family Notch domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001002827.1.4139
Sequence length 1961
Comment neurogenic locus notch homolog protein 4 precursor [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MQRQWLLLLLLPLSFPVILTRELLCGGSPEPCANGGTCLRLSQGQGTCQCAPGFLGETCQ
FPDPCWDTQLCENGGSCQALLPTAPSSHSPTSPLTPHFSCTCPSGFTGDRCQSPLEELCP
PSFCSNGGHCSVQVSGRPQCSCEPGWTGEQCQLRDFCSANPCANGGVCLATYPQIQCRCP
TGFEGHICERDVNECFLEPGPCPRGTSCHNTLGSFQCLCPVGQEGPQCKLRKGACLPGTC
LNGGTCQLVPEGDTTFHLCLCPPGFTGLNCEMNPDDCVRNQCQNGATCQDGLGTYTCLCP
KTWKGWDCSEDIDECEAQGPPRCRNGGTCQNSAGGFHCVCVSGWGGEGCDENLDDCAAAT
CALGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLRQPCHVNAQCSTNPLTGSTLCICQPG
YSGPTCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLSQP
CHPGSTCLDLLATFQCLCPPGLEGRLCEVEINECASNPCLNQAACHDQLNGFLCLCLPGF
TGARCEKDMDECSSAPCANGGHCQDQPGAFHCECLPGFEGPRCETEADECRSDPCPVGAS
CLDLPGAFLCLCRPGFTGQLCEVPLCSPILCQPGQQCQDQEHRAPCLCPDGSPGCVPAED
DCPCHHGHCQRSLCVCNEGWTGPECETELGGCLSTPCAHGGTCHPQPSGYNCSCLAGYTG
LTCSEEITACHSGPCLNGGSCSIHPEGYSCTCPPSHTGPHCQTAVDHCASASCLNGGTCM
SKPGTFFCHCATGFQGLHCEKKIHPSCADNPCRNKATCQDTPRGARCLCSPGYTGSSCQT
LIDLCARKPCPHTARCLQSGPSFHCLCHQGWTGSLCDLPLSCQAAAMSQGVEISNLCQNG
GLCIDTGSSYFCRCPPGFEGKLCQDTVNPCTSKPCLHGATCVPQPNGYVCQCAPGYEGQN
CSKVHDACQSGPCHNHGTCTPRPGGFHCACPPGFVGLRCEGDVDECLDRPCHPSGTASCH
SLANAFYCQCLPGHTGQRCEVEMDLCQSQPCSNGGSCEVTTGPPPGFTCRCPEGFEGPTC
SRKAPACGNHHCHNGGLCLPSPKPGSPPLCACLSGFGGPDCLTPPAPPGCGPPSPCMHNG
SCTETPGLGNPGFQCTCPPDSPGPRCQRPGANGCEGRGGDGACDAGCSGPGGDWDGGDCS
LGVPDPWKGCPPHSQCWLLFRDGRCHPQCDSEECLFDGYDCEIPPTCTPAYDQYCRDHFH
NGHCEKGCNNAQCGWDGGDCRPEGDDSEGGPSLALLVVLSPPALDQQLLALARVLSLTLR
VGLWVRKDSEGRNMVFPYPGTRAKEELSGTRDSSSWERQAPHTQTPGKETESLGAGFVVV
MGVDLSRCGPEHPASRCPRDSGLLLRFLAAMAAVGALEPLLPGPLLAAHPQAGTGSPATR
LPWPILCSPVVGVLLLALGALLVLQLIRRRRREHGALWLPPGFIRRPQTQQAPHRRRPPL
GEDNIGLKALKPEAEVDEDGVVMCSGPEEGEAEKTASASRCQLWPLRSGCEGLPQAVMLT
PPQECESELPDSDTCGPDGVTPLMSAVFCGGVQSTTVQRLGLGNPEPWEPLLDRGACPQA
HTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHTAVAADAREVCQLLLA
SRQTAVDARTDDGTTPLMLAARLAVEDLVEELIAARADVGARDKRGKTALHWAAAVNNAR
AARCLLQTGADKDAQDSREQTPLFLAAREGAVEVAQLLLEIGAARGLRDQAGLAPADVAR
QRSHWDLLTLLEGAGPITQEARSHARNTPGGGAAPRCRTLSAGARPRGGGACLQARTWSV
DLGARRGAVYARCRSRSGGSGGPSMRGRRLSADSRGRRGARVSQDDWPRDWVALEACGSA
CSAPIPPPSLTPSPERGSPQVSWGLPVHQEVPLNSGGRNQN
Download sequence
Identical sequences Q6MG89
10116.ENSRNOP00000000513 NP_001002827.1.100692 NP_001002827.1.4139 ENSRNOP00000000513 ENSRNOP00000000513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]