SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001003768.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001003768.1.45394
Domain Number 1 Region: 6-65
Classification Level Classification E-value
Superfamily Chromo domain-like 9.54e-19
Family Chromo domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001003768.1.45394
Sequence length 411
Comment chromobox protein homolog 6 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MELSAAGDRVFAAEAILKSRVRKGHIEYLVKWKGWALKHSTWEPEENILDDRLIKAFEQK
EREQELYGPKKRGPKPKNFVLKARAQSGDRPRSSYTRRTPSCTTAKPPTASSSASSATPQ
PSSSSSHSTAPTPRVHSLAAAHKLKKDIHRCHMMSRRPLPRSDPLANSTGSSSRHPISPF
SETVRILNRRVKPREVKRGRIILNLKVIDKSENGGMTSRRTPQSFAGRAKIPSRNRIIGK
KHGDMPYRPFQHPMKMLGIPMYGQPFGLNPSGGASSMANEGSNTRASHGGGSRCGSQSSA
QRFQYQPTPSPSNSSGSNGSSPSTQKQPTQKEGPTSSAKLTPTESSRSHDTSQPHPKSSS
TPFLPSSPSYSSSPSSSQEDEDLGSLKSATSRGRKQELRHQTQVGRASVCQ
Download sequence
Identical sequences Q6AZW3
7955.ENSDARP00000095582 ENSDARP00000095582 NP_001003768.1.45394 ENSDARP00000095582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]