SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001003819.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001003819.1.92137
Domain Number 1 Region: 649-840
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-47
Family SPRY domain 0.0000279
Further Details:      
 
Domain Number 2 Region: 23-116
Classification Level Classification E-value
Superfamily RING/U-box 4.95e-30
Family RING finger domain, C3HC4 0.0072
Further Details:      
 
Domain Number 3 Region: 356-441
Classification Level Classification E-value
Superfamily RING/U-box 1.15e-24
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 4 Region: 116-180
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.41e-18
Family B-box zinc-binding domain 0.0012
Further Details:      
 
Domain Number 5 Region: 445-506
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000114
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001003819.1.92137
Sequence length 842
Comment tripartite motif-containing 6 and tripartite motif-containing 34 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MCGSERILQAGNILEIRVGQAGARRVATMTSPVLVDIREEVTCPICLELLTEPLSIDCGH
SFCQACITPNGRESVIGQEGERSCPVCQTSYQPGNLRPNRHLANIVRRLREVVLGPGKQL
KAVLCADHGEKLQLFCQEDGKVICWLCERSQEHRGHHTFLVEEVAQEYQEKFQESLKKLK
NEEQEAEKLTAFIREKKTSWKNQMEPERCRIQTEFNQLRNILDRVEQRELKKLEQEEKKG
LRIIEEAENDLVHQTQSLRELISDLERRCQGSTMELLQDVSDVTERSEFWTLRKPEALPT
KLRSMFRAPDLKRMLRVCRELTDVQSYWAIQGSLTRRERRASGVRTRRSQGSSAMASKIL
LNVQEEVTCPICLELLTEPLSLDCGHSLCRACITVSNKEAVTSMGGKSSCPVCGISYSFE
HLQANQHLANIVERLKEVKLSPDNGKKRDLCDHHGEKLLLFCKEDRKVICWLCERSQEHR
GHHTVLTEEVFKECQEKLQAVLKRLKKEEEEAEKLEADIREEKTSWKYQVQTERQRIQTE
FDQLRSILNNEEQRELQRLEEEEKKTLDKFAEAEDELVQQKQLVRELISDVECRSQWSTM
ELLQDMSGIMKWSEIWRLKKPKMVSKKLKTVFHAPDLSRMLQMFRELTAVRCYWVDVTLN
SVNLNLNLVLSEDQRQVISVPIWPFQCYNYGVLGSQYFSSGKHYWEVDVSKKTAWILGVY
CRTYSRHMKYVVRRCANRQNLYTKYRPLFGYWVIGLQNKCKYGVFEESLSSDPEVLTLSM
AVPPCRVGVFLDYEAGIVSFFNVTSHGSLIYKFSKCCFSQPVYPYFNPWNCPAPMTLCPP
SS
Download sequence
Identical sequences B2RNG4
gi|51477690|ref|NP_001003819.1| ENSP00000346916 9606.ENSP00000338711 ENSP00000338711 ENSP00000346916 ENSP00000346916 NP_001003819.1.87134 NP_001003819.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]