SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001006076.2.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001006076.2.45394
Domain Number 1 Region: 344-537
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-54
Family Ypt/Rab-GAP domain of gyp1p 0.0026
Further Details:      
 
Domain Number 2 Region: 515-637
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.15e-29
Family Ypt/Rab-GAP domain of gyp1p 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001006076.2.45394
Sequence length 717
Comment TBC1 domain family member 16 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MSFGRLLRRASSKASDFLTFNVGTGGSRSVLDGEIIFSKNNVCVHPAEPLPGLPEHHPGY
LCVHLEKDETLGSTLILTWVPNSRIQRQDEEALRYITPESSPVRRNPRRRAHRSHSRPPA
APEEEEAADEEGQEPQNQALLEEGDEGSCELSADEVSRDSTIGSDSDTFSSPFCLSPVSE
ALGESSSSVFLDNESRECDEPMAHSASSASSLDSHAPSESSHSQGVRWEEQQNVMALEHL
CGVFRVDLGHMRSLRLFFSDEACTCGQLVIASRESQYKILHFHHAGLDKLAEVFQQWKCC
RETQLKDQVSDEKSCMQFSIRRPTLPSAEMHPEERLYRRLDVSSWLRHLNNSGQVLEEYK
LRKAIFFGGIDPSIRGEVWPFLLHYYSYDSTSEEREAWRLQKRGEYQDIQQRRLSMSPEE
HSEFWRKVQFTVDKDVVRTDRSNMFFRGENNPNVEIMRRILLNYAVFNPDMGYCQGMSDL
VAPLLTEIQDESDTFWCFVGLMENTIFISSPRDEDMERQLMYLRELLRLMLPRFHQHLTR
LGEDGLQLLFCHRWVLLCFKREFPDAEALRMWEACWAHYQTDYFHLFLCVAIIVLYGDDV
TEQQLATDQMLLHFSNLSMHMNGELVLRKARSLLYQFRLLPRIPCSLHDLCKLCGPGMWD
SRYIPAIECSGEHPDSQSCPYGGTATPESPPLPSPNQPIEGKRGSKKRDIFTFRKHS
Download sequence
Identical sequences E7FE32
ENSDARP00000114150 NP_001006076.2.45394 ENSDARP00000095052 ENSDARP00000122393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]