SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001009352.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001009352.1.62641
Domain Number 1 Region: 143-280
Classification Level Classification E-value
Superfamily TNF-like 8.61e-38
Family TNF-like 0.00036
Further Details:      
 
Weak hits

Sequence:  NP_001009352.1.62641
Domain Number - Region: 46-61
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000392
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 3-70
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0915
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001009352.1.62641
Sequence length 280
Comment tumor necrosis factor ligand superfamily member 6 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MQQPLNYPYPQIYWVDSRASSPWGPPGSVLPCPSSVPGRPGQRRPPPPPPPTLPPPPPPP
PLPPLPLPPLKTRRDHNTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQK
HVASSLEKQIGQLNPPSEKRELRKVAHLTGKPNSRSIPLEWEDTYGIALVSGVKYKKGGL
VINDTGMYFVYSKVNFRGQSCNNQPLNHKVYMRNSKYPQDLVLMEGKMMNYCTTGQMWAR
SSYLGAVFNLTSADHLYVNVSELSLVSFEESKTFFGLYKL
Download sequence
Identical sequences Q861W5
NP_001009352.1.62641 ENSFCAP00000005431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]