SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001009560.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001009560.1.45394
Domain Number 1 Region: 484-649
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 4.05e-72
Family A middle domain of Talin 1 0.0000000959
Further Details:      
 
Domain Number 2 Region: 749-885
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.02e-53
Family I/LWEQ domain 0.00000114
Further Details:      
 
Domain Number 3 Region: 2290-2479
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.16e-51
Family I/LWEQ domain 0.0001
Further Details:      
 
Domain Number 4 Region: 655-779
Classification Level Classification E-value
Superfamily I/LWEQ domain 9.03e-49
Family I/LWEQ domain 0.0000023
Further Details:      
 
Domain Number 5 Region: 1840-1968
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.18e-41
Family VBS domain 0.0000033
Further Details:      
 
Domain Number 6 Region: 1221-1357
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.49e-39
Family VBS domain 0.016
Further Details:      
 
Domain Number 7 Region: 195-308
Classification Level Classification E-value
Superfamily Second domain of FERM 8.77e-36
Family Second domain of FERM 0.000000788
Further Details:      
 
Domain Number 8 Region: 1071-1203
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.39e-22
Family VBS domain 0.049
Further Details:      
 
Domain Number 9 Region: 309-395
Classification Level Classification E-value
Superfamily PH domain-like 9.38e-21
Family Third domain of FERM 0.0000107
Further Details:      
 
Domain Number 10 Region: 1464-1551
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000366
Family I/LWEQ domain 0.0075
Further Details:      
 
Domain Number 11 Region: 2003-2127
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000832
Family VBS domain 0.019
Further Details:      
 
Domain Number 12 Region: 80-135
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000621
Family First domain of FERM 0.045
Further Details:      
 
Weak hits

Sequence:  NP_001009560.1.45394
Domain Number - Region: 917-979
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000785
Family I/LWEQ domain 0.0055
Further Details:      
 
Domain Number - Region: 1684-1805
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00135
Family VBS domain 0.046
Further Details:      
 
Domain Number - Region: 1595-1655
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00235
Family alpha-catenin/vinculin 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001009560.1.45394
Sequence length 2538
Comment talin-1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MVALSLKIGVGNVVKTMQFEPSTVVYDACRIIRERVPEAQLGQPSDYGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTLEYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIG
ITNYDEYSLVRDVGEEKKEETTGTLKRDKTLLRDDKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEESEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
YQCQIQFGDHNESKHKPGFLDLKEFLPKEYVKNKGEKRIFQAHKNCQNMTEIEAKVNYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWSLTNIKRWA
ASPKDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSV
SPKKSTVLQQQFNKMGKVETGSVALPAIIRSGAGGPESMKMGSMPQAKQHITSGQMHRGH
MPPLTSAQQALTGTINSSMQAVQAVQASLDEFDALPPLGTDSASQAWRKNKMDESKHEIH
SQVDAITAGTASMVNLTAGDPAETDYTAVGCAVTTISSNLTEMSKGVKLLAALMEDEGGN
GQQLLGAAKNLACAVSDMLKTAQPSSTEPRQNLLQAAGNVGQASGELLQQIGESDADQHF
QDMLMQLAKAVANAAAALVLKAKNVAQKSEDSAQQNKVIAAATQCALSTSQLVACTRVVV
APTISSPVCQEQLIEAGKLVAKSVEGCVEASHGATGDEHLLKQVGAAATGVTQALNELLQ
HIRQYASGGQPIGRHGEATDRILDVTDNIFSSMGDAGEMVRQARILAQATSDLVNAIKAD
AEGESDLENSRKLLSAAKLLADATARMVEAAKGAAANPDSEEQQQKLREAAEGLRMATNA
AAQNAIKKRLVNKLENAAKQAAAAATQTIAAAQHAASSNKNPAAQQQLVQSCKVVADQIP
QLVQGLRSSQAQPDSPSAQLALIGASQNFLQPGAKMVTAAKATVPTISDQASAMQLSQCA
KNLASALAELRTAAQKAQEACGPLEIDNALTMVRGLERDMQEAKASAAEGKLRPLPGETL
EKCSQDLGSSTKAVSSAIAQLLSEATQGNENYTGMAARDVAQALRSLASAARGVAANTED
PLARNAMLDCTGDVMDKSASLIEETKRAIAKPGDPDSQQRLAQVAKAVSQALNRSVNCLP
GQRDVDNAIRTVGEASKKLLSDKFPASGKNFQEAQANLNEAAAGLNQSANELVQASRGTT
QDLAKASGKFGQDFNQFLQAGVDMAGQSQSKEDQTQVVTNLKTISMSSSKLLLAAKALST
DPNSPNLKNQLAAAARAVTDSINQLISMCTQQAPGQKECDNALRELETVGGMLENPTEAV
NDLGYFDCIDSVMENSKVLGEAMAGISHNAKNSNLPEFGDSVSSASKALCGLTEAAAQGA
YLVGVSDPNSHAGQKGLVDPSQFARAKQSIQMACQNLVDPACTQSQVLSAATIVAKHTSA
LCNACRLASSKTSNPVAKRQFVQSAKEVANSTANLVKSIKALDGAFNQENRQKCKEATGP
LIEAVDNLTAFASNPEFASVPAQISPEGLAAMEPITAAAKAMLESSTGLIQTARSLAVNP
KDPPKWSVLAGHSRTVSDSIKKLITNMREKAPGQRECDDAIEVLSNCIREVDKASLAAIS
QQLTPRDDISHEALHEQMAASVHEISNLIEPVAIAARADASQLGHKVSQMVSYFEPLIMA
AIGTASKILNSQQQMNVLDQTKTLAESALQMLYTAKETGGNHKAAHTQEALEESVQMMKE
AVDDLGSTLAEVASAAGAVGGMVNSITQSINKMEDGPAFEPEGTFVDYQTTMVKTAKAIA
VTVQEMVTKSNTNPDELGGLANQLTTEFGDLASEAKCAAMTAENDEIGSHIKKQVTELGY
TCTGLVSKAGALQCSPNDSYTKKELIDSARKVSEKVSHVLAALQAGNRGTQACITAASAV
SGIIADLDTTIMFATAGTLNRENAETFADHREHILKTAKVLVEDTKLLVSGAGASQEKLA
QAAQSSVNTITKLADVVKLGAASLGSEDPETQVVLINAVKDVAKALGDLISATKAAAGKP
HDDPAMLQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATIEHIKQELAVFSSADP
PPKTATPEEFIRMTKGITLATAKAVAAGNSCRQEDVIATANLSRRAVADMLRSCKQAAYH
PEVKREVQTRALRFGSECSTSYLGLLEHVLVIIQKPSHDLKQQLANYSKRVASSVTELIQ
AAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNFEEQI
LEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANAVDDGQWSQGLISAARMVAAATN
NLCEAANSAVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSQTMKRLQAAGNAVKR
ASDNLVKAAQKAAFEAQDDQAVMVKSKMVGGIAQIIAAQEEMLRKEKELEEARKKLAMIR
QQQYKFLPSELREDGQEQ
Download sequence
Identical sequences Q5U7N6
NP_001009560.1.45394 ENSDARP00000025533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]