SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001009635.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001009635.1.100692
Domain Number 1 Region: 25-187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-18
Family SPRY domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001009635.1.100692
Sequence length 196
Comment SPRY domain-containing protein 7 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MAASAWCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGGCLASAPL
HQNKSYFEFKIQSTGIWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPA
NSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYH
TPPPGFEKILFEQQIF
Download sequence
Identical sequences Q3TFQ1 Q5M7T2
ENSRNOP00000020419 ENSRNOP00000020419 ENSMUSP00000022497 NP_001009635.1.100692 NP_001009635.1.4139 NP_079973.1.92730 XP_021059296.1.100879 10090.ENSMUSP00000022497 10116.ENSRNOP00000020419 ENSMUSP00000022497 GO.36161 mmk001002523.1 ENSMUSP00000022497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]