SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001010841.1.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001010841.1.86415
Domain Number 1 Region: 1-198
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-51
Family DBL homology domain (DH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 188-325
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-19
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 3 Region: 324-397
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-16
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001010841.1.86415
Sequence length 427
Comment ephexin-1 [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MFELVTSEASYCKSLNLLVSHFMENERLKKILHQSEAHILFSNVLDVKAVSERFLLDLER
RVEENIVISDVCDIVYQHTVDHFSVYITYVSNQTYQERTYKQLLQDKPAFREVITQLELD
PMCRGLSFSSFLILPFQRITRLKLLVQNILKKVEEKSERETTALEAHKELETVVKACNEG
VRKMSRTEQMISIQKKLEFKIKSVPIISHSRWLLKQGELQQMNGPKTSRTLRTKKLFREI
YLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELEDQGQSLANVFILRLLENADDREA
SYMLKASSQSEMKRWMISLAPNRRTKFVSFTSRLSDCPQIQCVHPYVAQQPDELSLELAD
VLNILDKTDDGWIFGERLHDQERGWFPSSIGEEILNPKIRAQNLKECFRVHKSDDSQRRK
LGSRNRQ
Download sequence
Identical sequences G1MSA6 Q5ZK41
ENSMGAP00000001169 ENSGALP00000040510 NP_001010841.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]