SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001010926.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001010926.1.92137
Domain Number 1 Region: 17-73
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000102
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 
Weak hits

Sequence:  NP_001010926.1.92137
Domain Number - Region: 82-121
Classification Level Classification E-value
Superfamily Orange domain-like 0.000209
Family Hairy Orange domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001010926.1.92137
Sequence length 166
Comment transcription factor HES-5 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQ
RPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW
Download sequence
Identical sequences Q5TA89
9606.ENSP00000367714 ENSP00000367714 ENSP00000367714 gi|58219048|ref|NP_001010926.1| ENSP00000367714 ENSP00000482150 NP_001010926.1.87134 NP_001010926.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]