SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001011209.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001011209.1.99540
Domain Number 1 Region: 20-242
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.35e-87
Family Eukaryotic proteases 0.000000828
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001011209.1.99540
Sequence length 243
Comment trypsin 10 precursor [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MKTLLLFSLLGLAVAQPIEDDDKIVGGYHCSVPYQVSLNAGYHFCGGSLINEHWVVSAAH
CYQSKMELRIGENNIELLEGTEQFIQSAKIIRHPQYNSWTIDNDIMLIQLQEPAQLNNEV
QPIPLPTECPPVGSICLISGWGNTLSNGVNYPDLLQCIEAPILSDQECRQSYPGSITDNM
ICVGYLEGGIDSCQGDSGGPVVCDGELQGVVSWGRGCALPGYPGVYTKVCNYLSWIRDTI
ANN
Download sequence
Identical sequences Q5M902
ENSXETP00000016875 8364.ENSXETP00000016875 NP_001011209.1.99540 gi|56611173|gb|AAH87759| gi|58332122|ref|NP_001011209| ENSXETP00000016875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]