SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001011251.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001011251.1.99540
Domain Number 1 Region: 5-248
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.61e-85
Family Eukaryotic proteases 0.00000438
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001011251.1.99540
Sequence length 249
Comment uncharacterized protein LOC496697 precursor [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MMPLWILLFLAVAAAAPLDDDKIVGGYECTPHSQPWQVYFTQNSQVFCGGSLVTPRWIIS
AAHCYRPPKTLVAHLGDHDLTKEEGTEQHIQVEAAYKHSSYKDEAYDHDIMLVKLAKPAQ
YNQYVQPIPVARSCPREGTECLVSGYGNLRSDHIGEFPDRLQCVDVPVLSDSSCKASCRG
LFTENMFCAGFLEGGKDSCQVDSGGPLVCNGELYGVVSWGWGCAQRNAPGVYAKVCNYLR
WVQNIIENN
Download sequence
Identical sequences Q5M8T8
8364.ENSXETP00000041815 NP_001011251.1.99540 gi|56611170|gb|AAH87830| gi|58332206|ref|NP_001011251| ENSXETP00000041815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]