SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001011316.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001011316.1.99540
Domain Number 1 Region: 10-59
Classification Level Classification E-value
Superfamily L domain-like 0.0000085
Family Ngr ectodomain-like 0.054
Further Details:      
 
Weak hits

Sequence:  NP_001011316.1.99540
Domain Number - Region: 92-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0062
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001011316.1.99540
Sequence length 164
Comment all-trans retinoic acid-induced differentiation factor [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MDGSDVIIGLDLWNCSLAQLDPTLHLTQAAVVLDLSSNPLRDLPSEFFRGLLGLQYVALP
AELSCPGGNNSWENVNVTSAVRVCQDQRSSCNSTSEWVLCPENSVCAPDGPGYMQCVCAP
GFHGYKCLRESTFPILMFFGILGLVTACLSVLLWCTQRRKVKSQ
Download sequence
Identical sequences Q5M8F4
gi|56789424|gb|AAH88051| gi|58332482|ref|NP_001011316| NP_001011316.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]