SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001015759.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001015759.1.99540
Domain Number 1 Region: 156-428
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.6e-85
Family Eukaryotic proteases 0.00000709
Further Details:      
 
Domain Number 2 Region: 49-109
Classification Level Classification E-value
Superfamily GLA-domain 2.02e-22
Family GLA-domain 0.00045
Further Details:      
 
Domain Number 3 Region: 133-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000762
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 4 Region: 98-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000781
Family EGF-type module 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001015759.1.99540
Sequence length 456
Comment vitamin K-dependent protein C precursor [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MNCLPPCRIWWPLIFYFILVIWESPKAKSSPVFSSRQEANHVLKVRKRAYNFMEELKPGS
LERECIEEKCDFEEAFEIFETREDTLNFWAKYFDGDQCQSNPCVNAVCKDGIGRFDCICN
EGWEGRLCKIEVEYSNCSLNNGGCMHFCTNTENSTSRVCSCAQGYRLNDDYKTCQPAVEF
PCGKLKIVDYGYSARLTGAKQGRKGDSPWQAMLRYEKKLKCGGVLIHPFWVLTAAHCVTH
AGKYTVRLGEYDIRKLEDTEQQFAVIKIIPHPEYESNTNDNDIALLRLVQPVVYNKYILP
ICLPSVDLAESNLTMDDTVVAVTGWGREDETALNYSSVLSYIQIPIAPRNQCAETLKDGV
SDNMLCAGQLGHIQDACYGDSGGPMVTKFGETWFLVGLVSWGEGCGRLNNFGVYTKVSRY
LDWIAQKMVEYEEAQRLSAASQTEKQNVNKSRKIRP
Download sequence
Identical sequences Q5FVZ2
NP_001015759.1.99540 gi|58476361|gb|AAH89695| gi|62751546|ref|NP_001015759| ENSXETP00000006481 ENSXETP00000006481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]