SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001016055.2.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001016055.2.99540
Domain Number 1 Region: 24-297
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.36e-85
Family Eukaryotic proteases 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001016055.2.99540
Sequence length 334
Comment uncharacterized protein LOC548809 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MRWRSIVPVSLTAAHTVAETMEFAGIILLLLVSASPTVSQNTTASPRICGSPLVSSRIVG
GTDATNGAWPWQISLRYKGSHICGGSVISNQWIMTAAHCFEYSRTPSDYQVLLGAYQLSV
ASASELLSSVARVIVNPSFTIPGGPGDIALLKLTSPVAYTEYILPVCVPSSASGFYEGMQ
CWVTGWGNIGSAVTLPYPQTLQQVMTPLISWSTCNQMYHVQSGISSNIAIVPKDQICAGY
AAGQKDSCQGDSGGPLVCQLQGVWYQIGIVSWGDGCAQASRPGVYTLVPNFKSWLSSYNA
TTDNPDTSSYAQKSHSPAIHIHTLLIATCLLLYS
Download sequence
Identical sequences B0JYS9
gi|166796549|gb|AAI58898| gi|167908783|ref|NP_001016055| gi|213627780|gb|AAI71053| ENSXETP00000013798 NP_001016055.2.99540 8364.ENSXETP00000013798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]