SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001019674.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001019674.1.59421
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily POZ domain 1.41e-29
Family BTB/POZ domain 0.0015
Further Details:      
 
Domain Number 2 Region: 394-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000114
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 363-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000027
Family Classic zinc finger, C2H2 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001019674.1.59421
Sequence length 498
Comment zinc finger and BTB domain-containing protein 43 [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MEPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVLAASSPYFCD
QVLLKNSRRIVLPDVMNPRVFENILLSSYTGRLVMPAPEIVSYLTAASFLQMWHVVDKCT
EVLEGNPTVLCQKLNHGSDHQSPSSSNYNGLVESFELGSGGHTDFPKAQELRDGENEEES
TKDELSSQLTEHEYLPSNSSTEHDRLSTEMASQDGEEGASDSAEFHYTRPMYSKPSIMAH
KRWIHVKPERFEQACEGMDVHAPYDEHQVTESINTVQTEYSVQPSGVEEDFHIGEKKVEA
EFDEQADESNYDEQVDFYGSSMEEFSGERSDGNLIWHKQEAALASGYSENIEMVTGIKEE
ASHLGFSATDKLYLCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMK
IHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEACTKSYEAAKAEQNT
TETCTKSYEAAKAEQNTT
Download sequence
Identical sequences Q58DD1
ENSBTAP00000004465 NP_001019674.1.59421 NP_001019674.1.76553 XP_010808630.1.76553 XP_019826418.1.53367 XP_019826419.1.53367 9913.ENSBTAP00000004465 ENSBTAP00000004465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]