SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001019710.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001019710.1.92730
Domain Number 1 Region: 99-284
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-56
Family Phosphotyrosine-binding domain (PTB) 0.000000182
Further Details:      
 
Domain Number 2 Region: 452-562
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-28
Family SH2 domain 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001019710.1.92730
Sequence length 573
Comment SHC-transforming protein 2 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MTQGPGGRAAPEPEAPTTFCALLPRMPQWKFAAPGSFLGRGPAATRVAGVAEAQPEPGVP
ALAAVLGACEPRCAAPCPLPALGRCRGSGTRGARVTPDVADEWVRKGGFIHKPAHGWLHP
DARVLGPGVSYIVRYMGCIEVLRSMRSLDFNTRTQVTREAINRLHEAVPGVRGSWKKKAP
NKALASILGKSNLRFAGMSISVNISVDGLNLSVPATRQIIANHHMQSISFASGGDTDMTD
YVAYVAKDPINQRACHILECCEGLAQSVISTVGQAFELRFKQYLHSPPKAVVPPERLTGL
EELAWGDDDAAADHNYYNSIPGKEPPLGGLVDSRLAVTQPCALATLGGLGQGMTPVWRDA
RGLPWDMGPSGAAPPGDGYVQADARGPHDYEEHLYVNTQGLDAVELEDTAEAPLQFEDSP
KKDLFDMRPFEDALKLHACSVAAGITAASPPLEDQWPSPPTRRAPIAPTEEQLRQEPWYH
GRMSRRAAEKLLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGVVRTKDVLFE
SISHLIDYHLKNGLPIVAAESELHLRGVVSREP
Download sequence
Identical sequences E9QLZ0 Q8BMC3
ENSMUSP00000020564 ENSMUSP00000129491 ENSMUSP00000129491 NP_001019710.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]