SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001020313.2.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001020313.2.4139
Domain Number 1 Region: 314-505
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-36
Family SPRY domain 0.00024
Further Details:      
 
Domain Number 2 Region: 28-99
Classification Level Classification E-value
Superfamily RING/U-box 1.06e-19
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 107-170
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000901
Family B-box zinc-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001020313.2.4139
Sequence length 515
Comment tripartite motif-containing protein 35 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MKAAASVVTAAAPAMEPGPSVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRRCVS
GCWEVQTTPSCPVCKERAVPGELRTNHTLNNLVETLLREEAEGARWTGRRSPRPCRAHRA
PLTLFCVEDKELLCCACQADARHQEHRVQPIKDTAQDFRAKCKNMEHVLREKAKSFWALR
RTYEAIAKHNEVQTTWLEGRIRDEFDKLRDFLRVEEQATVDAMKEESRKKHLLAEEKMKQ
LAEQTEALAREIERLQMEMKEDDMTFLMKHKSRKRRLFCTVEPAPLQPGLLMDACKYLES
LQYRVWKKMLGSVESVPFSLDPNTAAGWLKVADDLTSVINHGYRVQVENPERFSSAPCLL
GSQVFSKGSHSWEVDVGGLPSWRVGVVRVQAHAQAQAQADVGGEGHSHSCYHDTRSGFWY
LCRTQGVDGDHCMTSDTATAPLVQAMPRRLRVELECEEGELSFYDSERHCHLYTFHAHFG
EVRPYFYLGASRGDGPPEPLRICHLRVSIKEELDI
Download sequence
Identical sequences G3V769
ENSRNOP00000012528 10116.ENSRNOP00000012528 ENSRNOP00000012528 NP_001020313.2.100692 NP_001020313.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]