SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001021855.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001021855.1.50509
Domain Number 1 Region: 13-286
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-80
Family Calponin-homology domain, CH-domain 0.00000955
Further Details:      
 
Domain Number 2 Region: 4738-4809
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.15e-22
Family GAS2 domain 0.00057
Further Details:      
 
Domain Number 3 Region: 3705-3866
Classification Level Classification E-value
Superfamily Spectrin repeat 8.77e-21
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 3819-3969
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-20
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 5 Region: 1174-1293,1326-1352
Classification Level Classification E-value
Superfamily Spectrin repeat 3.07e-17
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 6 Region: 4060-4193
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-17
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 7 Region: 687-816,877-901
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-16
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 8 Region: 2938-3088
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000123
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 9 Region: 3596-3754
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000321
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 10 Region: 3048-3206
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000144
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 11 Region: 3381-3535
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000533
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 12 Region: 4366-4509
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000798
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 13 Region: 2828-2953
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000152
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 14 Region: 2080-2234
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000111
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 15 Region: 4273-4412
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000628
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 16 Region: 600-728
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000448
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 17 Region: 293-401
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000048
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 18 Region: 3988-4085
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000484
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 19 Region: 3262-3383
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000106
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 20 Region: 987-1080
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000563
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 21 Region: 4461-4601
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000223
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 22 Region: 538-631
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000249
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 23 Region: 4203-4306
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000777
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 24 Region: 1973-2119
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000442
Family Spectrin repeat 0.021
Further Details:      
 
Domain Number 25 Region: 1860-2015
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000837
Family Spectrin repeat 0.018
Further Details:      
 
Weak hits

Sequence:  NP_001021855.1.50509
Domain Number - Region: 2623-2739
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000446
Family Spectrin repeat 0.02
Further Details:      
 
Domain Number - Region: 2507-2608
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000456
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 1431-1548
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00187
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 810-867
Classification Level Classification E-value
Superfamily SH3-domain 0.00207
Family SH3-domain 0.0017
Further Details:      
 
Domain Number - Region: 4638-4722
Classification Level Classification E-value
Superfamily EF-hand 0.00306
Family Polcalcin 0.054
Further Details:      
 
Domain Number - Region: 2310-2446
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00345
Family Spectrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001021855.1.50509
Sequence length 4955
Comment Uncharacterized protein CELE_ZK1151.1 [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MVGERYRSHHAVDPSDAQEKEVLDHYELNREKYNDERDNVQKKTFTKWVNKHLSKTDHKI
DDLFVDLRDGYALIALLEALTGERIQKENGYTRFHRIQNVQYCLDFLKKKNIKLVNIRPE
DIVEGNGKLTLGLIWTIILNFQVSVIRQRLLLESSQHEQMSAKHTTTNSQVSLHGSDATS
ARDALLQWARRVTAGYPRVNVNNFSSSWRDGLAFNAILHRYRSSAIDWNKISSDSVSNTE
RLNNAFAAADREFGVERLLDAEDVDTNNPDEKSIITYVSSLYNALPHEPEMSRLQKVQEE
YIEEAYEWREWVVRAIQLVDDRHLQGTASELIYELQRFREDDLPPREEQKRRLTLVYEHL
EKVMRSTELFAIPHELSAPELQRVWNELQNSIDRRFDVLERHRIQEGNSNDLLSRLARGI
GITNEKLDLILKRIEDVEARVDTSPPAAVERTVSEIVDDLNALESPIARFFEDVEELKSM
QHPEANDFYKQVYGLHQRRTTYLDRLTNQILVRLGVRTDSLHKENQQRLENMRKTSFSRV
EECIEWVRVRMEKLTTMEFLEDLETLEHVFEQHKFDNRDIQDFRQNVDECIARQAEVSAE
DTYEYCELLRVLESEYQQLRDLSAGRMLDLDSLIAFVRAAQLELIWVSERESIEVTRNWS
DIKQLDLPMLTNYYKQLLHEMELREKQYNDVHNQGAALLNQGHPAIRVIEVYLRQMQSQW
DWLLALSKCLEEHLRDALNLKSFMEEASDAEAWIQEQSVRLENNYNRTDFSLEEGERFLR
ELDEIKEILNKYHQVLMALTERCASISPLWQRGERIPHPIKVTALCDYSDENVTIKAGDD
VYLLDNSDLIKWTIRDISGAEGQVPSVVFRIPPTDARLTALLNRLLQQFEKLKKLWDKKH
RMVRFNMVLNTMRTIQGWDLDTFNSIDPDQRDAIMKALNDDANKLLSELDPNDPLALRLR
EELRRTNEHFWNLLNASQKPPEPDWASQYDQKMAELLKKLEEAWRELNDAVGKPISRSPE
DLERVIHAHKRFEDALQALDSDVANVKELFRQLPNPTPTQRVNHDRLNGLWDDLWDLSRM
YVERIKVLESVLNGMVEVADIVRQHEITLNSFDDLPAALDKLRGHHSQLLEINMVLKVSK
LGAQNEHFSQQQTVIDQLNRNVALLRQHVSRTRINEGHHPDVDAIEDEVQKLNVRWENVN
SQIASRLLAVESALQIQMVYRSEYETEMSWLDTVEETINRLRKPEELRPEQYQQQLDMLI
AEYTNLQEHTQAIEHVNKEGGRFIHEAKIFDAKLGQYSDGIVGIHGPGIKSEFRRTKPQP
KNGSQIVTEELELLNRRFAQLSSLILERRNTMQVLIQNWKRQKQENVTQVVSFREAEVSG
MMTDLTRFRQEIFTTHLTFNSNPESIDAATKNVQNVKQSLDSWRDRIKERLDEIDRLCTE
EGDSLTPEQYSALREMRRQLADEYDTVLRTVEGIHTRLNILSALLIEFSSVTSSMQSWMT
DRTRLAGDIRHKSGDPMRIDEARFEAKSLMDEVIREESRLKTIGASVLKIEQEISAMRDD
VRASGSTDDVGISVDEVYETRRRVEDDYMQLLRQCQDLISFQNRLHAMNDEHSEQARRAD
EWLQMLQNDVEDVDQDPRFQRDEDRIQRIEELNRMAAGGSSQLDDAEQASRRLLTALEGT
NVANDVRARHEELANLRRGKHQKVIDRLSQNMMEAASRKAEAEGVKQAVENLRQWSEQTA
QRTRQPVQLPLTELDLHEARKDEQVLHGEIENRLALIEELEKKAADVGDHASLAELQECK
MKLKRSNSDLKGLRDNIFDAINGLQTVNSEGETLSRAVDSAGAKIRSARLPEAQSEVEAL
QDQADNLERITNNLCNIPNVTRTEPVIQKSKDLRKRVDSCAQELDARMGKLAELESLDAE
FDGAKNKLSSFIGAFDDELKGLEKVSIDKEKLAEQRRQTQDLVDKHSEGNAILDDVEAIA
QKVTAEDPSKTGSAQKSVGELGARLQRQASELKARGDKINKLDSKATSFAESEAAVLGYI
EKQKDQLSTGFPVPATKEGVKSQLLDLERMNKTGKEEQRRVDDARHSARELAREASVEKE
VQDMNQREKKLLDEWEDLADQFDAVRSRANKAEQVLNECAQMEKYIGAKKNMLEGIGAPS
TEPGVAKANRAQIQSMKAETEGEKSALEHVNSLANELIADGGANVEELMKKMDRLNRKWH
SLESGLDENAGRVEEAAKLGQELKDIQKELRKELGELESNVEKASAMSSNDIGDQLATLD
SLKSRFGGVDKALEKLKGILEATEELEVDATNRAEIQEQLETTQKKADELERKIENVKKA
ALNAQNEGLELEKKLDELIGTVNSAENELELAAPIAAESLKLADELKRAEELFQKLIENE
GDVSLIRAKVAEELKKKPDAELKKKLELLYQKWPKALGAARDRKDLVSKAGDLVKQFGDQ
VQALEQRLQGDQAELDELLASDKAHDPEVCDALKLVELTMARRLADVDALNAVMNRIESS
APGPDANRLRRRADTLSDDAKGMAKKARTAADLAQRKQGLAKKFERLCDEVSQFTENQKA
EIQDAIEKDLLNAERVQSKLNKIDDFWSSNSRELKNVGDEIKIDATPEDAQAVDTKLAEL
QAGIDGLLATLQEQNVHLEEKREQANRVQSESQKAAGKINSLVAEIADLDPIGRSRDELQ
KQKKEVVELAGDLGSAQTKMLELGAEWEAALGAGIVAQPVFEMNRAATDELNKLAARAGK
RLAQREKKITETEDEIDKLHADADQIVGALEAIAKDEALQGAPSQLLDPKQVSEKVRQLK
ESLKPVGEKMDAFNTDCKLLIKTAGPESDTKELDSLLKKVGDAYSDVVGKVSDKEMSVDA
AVQQQGKVEDAYRALLNWLEETEEMMENRKKPSADAKVAKAQLHDYEVLMKHVEDKKPSV
DGFKAMIEKIVAEASSDEEKKALGNKNAQIEDRYKDLLNSAVDRQRKLLDAVDLAERLQE
VTIPLDSWLQSADKRLQALAKVPITVEKAEEMIGEQEALQDELEHKSDDLKDVLEIAPML
ASLVSVEDANSISGQVNQLEARARALDAGITNMRPLLESFLQQIQDFTLDAEDMTQFVGE
TEVKLGELDELPIEPDDLVEQTNILAEIAVSIADRDEMMANIFEVGKQLAIQGEPEEALI
AQKKLDDLKFRYADLMTSADEKIALLAKAIPLSEGFHEGFDTVMQVLEDMDRDLQTIDEE
DPETQAELIFLLEEDISQKMRPSVDELTALSNQLQVLCSADKADELQTNTIAMNKLVNSV
ADRVARRAERIEMASKQSRAVLDDLQYLIEWFSAARERILEGAPPSLDLEVLKSQLKHQR
ITNEEASANKVQFRNVAGEAKKVARQLGMEGNEANEKISDTVDEGKELVEEVMALCADRT
ETLERALALMEQLTSQFDELNKWLDQMDAELQASPSVTTATPAAELREMHDHNEELARMV
AAYRPIIEGFKSDVGSLHEVLAEDQAPLLESVAGELVQGYEEVREAVRARGHAIDNMMGA
TIGFGERLETLVANLQGAADRLRENEGISADPSVLESRLAENRSIVESLRDKQNAYDALK
QTASELLASAPEGDAAAGDVENKLNRLEKLWKEIEREAVDRGVLLEDVLDKAKHFWSELD
SCQKAVDDLRNRLELVEPATGHPEQLADQQEIMAQVASEMERARPRIEALSIAGKQLADY
VPDDEKAVIENQVANVRGGFSTITGLFAEKKRDLIAAMEEAMTFHGDLQELLKWLDMAEQ
KLLKMSPVEHAKHMTEIEQLLKELHTFKDEVHERGVAKEQVVATALQLAADAPPHLAATV
RQPVADLNTRWSRLNAALAEREHKLENLMLQMGKLASTIAQLTAWMDKTRATLKDIAPPK
NAVNLRDIEIAQCKLVVLSNDIHAHQDSVNAVNRAAQKYIQTSGALDAETSDSLKSMNLK
WEDIQKVLESLAFDMEVAKKEAENVGGEVEKWQRWLEETESALLSTKPTGGLPETAEFQL
DEFKALKLDVEHNASPLEAHLHATEQHLKEEPQDADTWLSKTHGAMKTKWNKVKELLVDR
EKKLQVAYEQAVALESALNDMEDWIIAAERKLTDQPSISRLPDVIEKQLAEHESWMEEVA
GRKMAMTKHQASGVHMQYYCEKKDAIPIKNRLVSLKHRVEKISGRTAERAKQLAVTRDEV
ATWQDGLHDLEHFISDVLVKIAPEPNTTSSLEKLKAKLEEVKEAQRDVTAKQTLFDVTRK
RGIGLAERATRSEYKQISMTNEKMSKKWAEMLKKLRDRLREAEQAVLEGGAFEESMNDLE
SWVDDELERYQKAEHEPVFADIDGVRALVDEESRRSAERKTKENGVKTVVKKADALMASG
VDEKDSIAQAKERLVEKWNQVEEAARHRGNSIKEAEQAAEEFDAKTHALLDWLAVEEQKL
KASGLDEVEGVKQEMDEAKGRYQECLKKGEEILSKCQPAAEPILRNWMRVVEARWKEVSE
KVDEREFTLLEQEQKAKEQNEQIEKLAKFAAQKREELNRMIEQPPAQDLDTMEQNICDFA
NLDSELREQQPEVDAACKSAKKGARNPAAEMLSTEWKKLWLDAMGLQSSLDNQKALLEEM
KRLEGWKWEDWKERYVEWNDHAKARVNDLFRRIDRLHTGNVPRQVFIDGIIGSNYVPNST
IVYSKFPTSRLEMAKVADRFDKGDGMINAKEFINALRFDASNRNAKPQTDTEKITHEIEL
QKKTCSCCTPYQIEKISENHYRFGDTHIKRMVRILRSTVMVRVGGGWESLDEFLHKHDPC
RAKGRLNINMFPEARPIHALDSMRSFTKNRHGKQLPTTGTPGPIMKIREKTDRSVPMSGG
LGGTAGYTVTTDSHRHTDARPSRIPRAPSDMSAGRLSRVGSVSNSKNSIVDSSTPSRPES
RASSDAGDRQTRIPSLRARKGQRYIPQGPSSSSSK
Download sequence
Identical sequences G5EDD3
6239.ZK1151.1c ZK1151.1c NP_001021855.1.50509 ZK1151.1c ZK1151.1c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]