SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001022235.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001022235.1.50509
Domain Number 1 Region: 193-420
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-34
Family Nuclear receptor ligand-binding domain 0.00013
Further Details:      
 
Domain Number 2 Region: 35-117
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-29
Family Nuclear receptor 0.00011
Further Details:      
 
Weak hits

Sequence:  NP_001022235.1.50509
Domain Number - Region: 138-180
Classification Level Classification E-value
Superfamily Bacteriophage trimeric proteins domain 0.0915
Family Lactophage receptor-binding protein N-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001022235.1.50509
Sequence length 593
Comment Nuclear Hormone Receptor family [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MFAPSTVYTYGHHGSGTDEDDGQQVMPGMDNGDGQCMVCGDRSAGKHYGVMACYGCKGFF
RRTIRSQQTYTCRFTQKCAIDKDQRNACRYCRFQRCLTVGMEPEAIRPDRDVIGKQKNPR
KKKMKSDTNSGSIDASLPSPNGCDSPVSNNEDVILSFLLDVEDQATCGNNHITMPIGISM
MMKNDPDFDVSTLFHSQYVRNQESFPITYAVGRTASVEQLIAALRRYVLSAVHWIDALFN
LAHLTEIHDKTTLLKSVIGPFTIFNIAARTAQISDGDLICLCNKSTINRQPARHLLDTNL
VGNNFVGRVIDDLVFPTKKLALTNPEITILSALIILDPDARGLSQETSQALLGIRDRVQN
ALFNLIRDNSNNMTSVTSRFGNLLLLFPPLAKLSSLIGENVQLAKMFGIPIDSLLVELYV
DADSPELISQGSHARERSDVSTQTASLEGASASMTPDVTSSEFVKMEQNESPSSSEEPMC
IGAPATSSANAVATNLAADLLGLLPNFDATGLDLASAAAAAATSVNYSHFYGFGNLGGSL
DDSSSSGTGSVGSFAPHSAPPISNNVNPFAVHGFFDNSAPNTGVVHNQPFRFV
Download sequence
Identical sequences H2KZA1
K08A2.7 K08A2.A K08A2.5c.2 K08A2.5a.1 K08A2.5a.2 NP_001022235.1.50509 6239.K08A2.5a.2 K08A2.5a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]