SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001022877.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001022877.1.50509
Domain Number 1 Region: 10-184
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.04e-26
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00000602
Further Details:      
 
Domain Number 2 Region: 200-319
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.43e-23
Family Ricin B-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001022877.1.50509
Sequence length 325
Comment Probable N-acetylgalactosaminyltransferase 9 [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MIDSISDNTLAYHGDWSLSTGGFSWALHFTWEGLSEEEQKRRTKPTDYIRSPTMAGGLLA
ANREYFFEVGGYDEEMDIWGGENLEISFRAWMCGGSIEFIPCSHVGHIFRAGHPYNMTGR
NNNKDVHGTNSKRLAEVWMDDYKRLYYMHREDLRTKDVGDLTARHELRKRLNCKPFKWFL
DNIAKGKFIMDEDVVAYGALHTVVSGTRMCTDTLQRDEKMSQLLGVFHCQGKGSSPQLMS
LSKEGNLRRENTCASEENGNIRMKTCSKKAQFNERWAYENKMIRNLKSGKCMSTANLKPG
DNAIVVECDEKDEHQKWNFIDPAKA
Download sequence
Identical sequences Y47D3A.23b NP_001022877.1.50509 Y47D3A.23b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]