SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001025541.2.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001025541.2.86415
Domain Number 1 Region: 493-720
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7e-57
Family Eukaryotic proteases 0.0000000406
Further Details:      
 
Domain Number 2 Region: 109-207
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-36
Family Kringle modules 0.0000122
Further Details:      
 
Domain Number 3 Region: 297-381
Classification Level Classification E-value
Superfamily Kringle-like 4.83e-33
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 4 Region: 206-288
Classification Level Classification E-value
Superfamily Kringle-like 7.49e-33
Family Kringle modules 0.00014
Further Details:      
 
Domain Number 5 Region: 376-474
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-26
Family Kringle modules 0.00058
Further Details:      
 
Domain Number 6 Region: 32-121
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 9.02e-24
Family Hairpin loop containing domain 0.0000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001025541.2.86415
Sequence length 726
Comment hepatocyte growth factor precursor [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MWATQLLPALLLHQLLLPPITIPAAEGKGKRRNPLHDYKKTGELMLIKVNKTLEVKTKLL
NTTEQCAKRCSRNKGLSFTCKAFAYDRVTKRCHWLSFNSLTNGVRKKQDHAFDLFEKKDY
VRNCIIGKGAEYKGTISITKSGIQCQAWNSMIPHEHSFLPSSYRGKDLRENYCRNPRGEE
GGPWCFTTSPQMRHEVCDIPLCSEVECMTCNGESYRGPMDHTESGKECQRWDLQRPHKHK
FRPERYPDKGFDDNYCRNPDGKLRPWCYTLDPNTPWEFCAIKTCDVGILNSTEAVAETTT
CIQGQGEGYRGTVNTIWSGIQCQRWDSQFPHQHNITPENFKCKDLRENYCRNPDGSESPW
CFTTDPNIRIGYCSQIPKCDVSNEQDCYRGNGKSYMGNLSKTRFGLTCSTWDKNIEDLRR
HIQIFREPDVSKLKKNYCRNPDDDFHGPWCYTDDPLIPWDYCPISRCTGDTTPTTTSLDD
TVIPCASTKHLRVVNGIPTQTNEGWVVSLTYRNKHICGGTLVKEEWVLTARQCFPSRYKD
LKDYKAWLGVHNIKGKGEEKHRQVRNISQLVYGPAGSDLVLLKLSRPAILTNFVEIIRLP
ISGCTIPEKTSCSVFGWGYTGLPNYDGLLRVANLFILGNEKCNQYLKGKITVNESEICAV
AETIGAGPCERDYGGPLVCEQNRLKIVVGVIVPGRGCAIRNRPGIFVRVSYYSRWIHKIM
MTYRKP
Download sequence
Identical sequences A0A1D5PAR6
9031.ENSGALP00000013774 ENSGALP00000038999 NP_001025541.2.86415 ENSGALP00000039002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]