SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001026499.1.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001026499.1.86415
Domain Number 1 Region: 242-337
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000247
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 2 Region: 131-195
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000152
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001026499.1.86415
Sequence length 619
Comment UPF0469 protein KIAA0907 homolog [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MSAGGGGQRDAGTAGGRRSKWDQPGPAPAFLLSGAAPLPGRPFPGGGDGGTAVGVSESSA
APSGALDAAAAVAAKINAMLMAKGKLKPAPNTADKLQALGKGPATNKSKDDLVVAEVEIN
DVPLTCRNLLTRGQTQDEISRLSGAAVSTRGRFMTAEEKAKVGPGDRPLYLHVQGQTREL
VDRAVNRIKEIITNGVVKAATGSSPTFNGATVTVYHQPAPITQMSPAVGQKPPFQSGMHY
VQDKLFVGLEHAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAF
EPMYIYISHPKPEGLAAAKKLCENLLQTVHAEYSRFVNQITTAVPLAGFAQPAAINSVPS
QPSYYPSNGYQSGYPVVPPPQQPVQPPYGVPGIVPPAVPMAPGVLTTLPTGVPPVPTQYP
ISQVQPPASTGQSPLSAPFLPAAAPVKTTLPAGTQPQVQPHPQGQKRRFTEELPDERESG
LLGYQHGPIHMTNLGTGFSSQSEIDGAGSKPASSSGKERERDRQLMPPPAFPVTGMKSES
EERNGVGSLPGSHDHQAKKMKTSEKGFGLVAYAGDSSDEEEEHGGHKNASTFSQGWSLGY
QYPSSQQRAKQQMPFWMAP
Download sequence
Identical sequences Q5ZL54
ENSGALP00000023567 NP_001026499.1.86415 ENSGALP00000023567 9031.ENSGALP00000023567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]