SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001027281.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001027281.1.81976
Domain Number 1 Region: 82-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000454
Family EGF-type module 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001027281.1.81976
Sequence length 234
Comment spitz, isoform G [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MHSTMSVQHGLVALVLIGCLAHPWHVEACSSRTVPKPRSSISSSMSGTALPPTQAPVTSS
TTMRTTTTTTPRPNITFPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQR
CEYKEIDNTYLPKRPRPMLEKASIASGAMCALVFMLFVCLAFYLRFEQRAAKKAYELEQE
LQQEYDDDDGQCECCRNRCCPDGQEPVILERKLPYHMRLEHALMSFAIRRSNKL
Download sequence
Identical sequences A4V0W1 Q01083
NP_001027281.1.81976 NP_476909.2.81976 NP_599118.2.81976 NP_599119.2.81976 NP_599120.2.81976 FBpp0080808 FBpp0080809 FBpp0080810 FBpp0080811 FBpp0100054 7227.FBpp0080809 FBpp0080808 FBpp0080808 FBpp0080809 FBpp0080810 FBpp0080811 FBpp0080812 FBpp0080813 FBpp0100054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]