SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001028254.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001028254.2.87134
Domain Number 1 Region: 311-391
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.97e-19
Family HLH, helix-loop-helix DNA-binding domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001028254.2.87134
Sequence length 394
Comment protein L-Myc isoform 3 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MCVCAGCRAAPSRRGAGPLQVAGGWSEGADMDYDSYQHYFYDYDCGEDFYRSTAPSEDIW
KKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASII
RRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGE
PKTQACSGSESPSDSENEEIDVVTVEKRQSLGIRKPVTITVRADPLDPCMKHFHISIHQQ
QHNYAARFPPESCSQEEASERGPQEEVLERDAAGEKEDEEDEEIVSPPPVESEAAQSCHP
KPVSSDTEDVTKRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKAPKVVILSKALEYL
QALVGAEKRMATEKRQLRCRQQQLQKRIAYLTGY
Download sequence
Identical sequences ENSP00000380494 NP_001028254.2.87134 NP_001028254.2.92137 gi|296923785|ref|NP_001028254.2| ENSP00000380494 ENSP00000361902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]