SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001028837.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001028837.1.100692
Domain Number 1 Region: 642-789
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-42
Family C-type lectin domain 0.0000054
Further Details:      
 
Domain Number 2 Region: 150-264
Classification Level Classification E-value
Superfamily C-type lectin-like 2.36e-41
Family Link domain 0.0048
Further Details:      
 
Domain Number 3 Region: 266-369
Classification Level Classification E-value
Superfamily C-type lectin-like 5.4e-30
Family Link domain 0.017
Further Details:      
 
Domain Number 4 Region: 43-154
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000159
Family V set domains (antibody variable domain-like) 0.064
Further Details:      
 
Domain Number 5 Region: 789-848
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000653
Family Complement control module/SCR domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001028837.1.100692
Sequence length 883
Comment brevican core protein isoform 1 precursor [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MIPLLLSLLAALVLTQAPAALADDLKEDSSEDRAFRVRIGAAQLRGVLGGALAIPCHVHH
LRPPPSRRAAPGFPRVKWTFLSGDREVEVLVARGLRVKVNEAYRFRVALPAYPASLTDVS
LVLSELRPNDSGVYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFAGAQEACAR
IGARIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQNPREACYGDMDGYPGVRNYGVVG
PDDLYDVYCYAEDLNGELFLGAPPGKLTWEEARDYCLERGAQIASTGQLYAAWNGGLDRC
SPGWLADGSVRYPIITPSQRCGGGLPGVKTLFLFPNQTGFPSKQNRFNVYCFRDSAHPSA
FSEASSPASDGLEAIVTVTEKLEELQLPQEAVESESRGAIYSIPITEDGGGGSSTPEDPA
EAPRTPLESETQSVAPPTGSSEEEGEALEEEERFKDTETPKEEKEQENLWVWPTELSSPL
PTGLETEHSLSQVSPPAQAVLQLGASPSPRPPRVHGPPAETLQPPREGSLTSTPDGAREV
AGETGSPELSGVPRESEEAGSSSLEDGPSLLPATWAPVGTRELETPSEEKSGRTVLTGTS
VQAQPVLPTDSASRGGVAVAPSSGDCIPSPCHNGGTCLEEKEGFRCLCLPGYGGDLCDVG
LHFCSPGWEAFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYREYQW
IGLNDRTIEGDFLWSDGAPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHL
SYTCKMGLVSCGPPPQLPLAQIFGRPRLRYAVDTVLRYRCRDGLAQRNLPLIRCQENGLW
EAPQISCVPRRPARALRSMTAPEGPRGQLPRQRKALLTPPSSL
Download sequence
Identical sequences G3V8G4
NP_001028837.1.100692 NP_001028837.1.4139 XP_006232658.1.100692 XP_006232659.1.100692 XP_017446132.1.100692 XP_017446134.1.100692 10116.ENSRNOP00000025496 ENSRNOP00000063799 ENSRNOP00000025496 NYSGRC-IgSF-ENSRNOP00000025496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]