SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001029542.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001029542.1.76553
Domain Number 1 Region: 322-604
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.16e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000118
Further Details:      
 
Domain Number 2 Region: 145-321
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.53e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000793
Further Details:      
 
Domain Number 3 Region: 606-712
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.5e-28
Family Anticodon-binding domain of Class II aaRS 0.001
Further Details:      
 
Domain Number 4 Region: 83-143
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000000109
Family TGS domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001029542.1.76553
Sequence length 723
Comment threonine--tRNA ligase, cytoplasmic [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MSEEQASSPSAKMGDEEKPVGAGEEKQKEGSKKKNKEGSGDGGRAELNPWPEYINTRLEM
YNKLKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIA
KVNKAVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIE
NGFYYDMYLEEGGVSSNDFSSLETLCKKIIKEKQAFERLEVKKETLLEMFKYNKFKCRIL
NEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNSSTYWEGKSDMETLQRIYGI
SFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLIEFI
RSEYRKRGFQEVVTPNIYNSRLWVTSGHWEHYSENMFSFEVEKELFALKPMNCPGHCLMF
DHRPRSWRELPLRVADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCL
DFLRTVYSIFGFSFKLNLSTRPEKFLGDIEVWNQAEKQLENSLNDFGEKWELNPGDGAFY
GPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVSHDGDDKKKPVIIHRAILGSVERM
IAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHNAKFMVDIDLDPGCTLNK
KIRNAQLAQYNFILVVGEKEKTSGTVNIRTRDNKVHGERTISETIERLQQLKHSRSKQAE
EEF
Download sequence
Identical sequences Q3ZBV8
NP_001029542.1.59421 NP_001029542.1.76553 XP_005887779.1.15283 XP_010852133.1.44457 9913.ENSBTAP00000018947 ENSBTAP00000018947 ENSBTAP00000018947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]