SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001029750.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001029750.1.76553
Domain Number 1 Region: 19-124
Classification Level Classification E-value
Superfamily L domain-like 1.25e-26
Family Ngr ectodomain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001029750.1.76553
Sequence length 306
Comment leucine-rich repeat-containing protein 59 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MTKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATVLDLSCNKLTTLPSDFCG
LTHLVKLDLSKNKLRQLPADFGRLVNLQHLDLLNNRLVTLPVSFAQLKSLKWLDLKDNPL
DPVLAKVAGDCLDEKQCKQCANKVLQHMKAVQADQERERQRRLEIDREAEKKWEAKQRAK
EAQERELRKREKAEEKERRRKEYDALKAAKREQEKKPKKETNQAPKSKSSSRPRKPPPRK
HTRSWAVLKLLLLLLLCVAGGLVACRVTELQQQPLCTSVNTIYDNAVRGLRSHDILQWVL
QTDSQQ
Download sequence
Identical sequences Q5E9X4
ENSBTAP00000007978 NP_001029750.1.59421 NP_001029750.1.76553 XP_006041216.1.26621 XP_010841091.1.44457 XP_019836610.1.53367 ENSBTAP00000007978 9913.ENSBTAP00000007978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]