SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001030278.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001030278.1.59421
Domain Number 1 Region: 42-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.46e-36
Family SCAN domain 0.00000505
Further Details:      
 
Domain Number 2 Region: 315-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000615
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001030278.1.59421
Sequence length 349
Comment zinc finger protein 174 [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MAAKMEITLSSQSHIQAFSKQERHIIAKLEEKREPALQEDWPDPELSRQSFRRFCYQEAS
GPQEALSHLRQLCRQWLQPEVHTKEQILELLVLEQFLNILPAEIQARARHRCPVSSKEIV
TLVEDFHRAAKGPKQWVAVCMEGQKVLLEKTGSQLGEQELPDFQPQTPRRYPREETFQAG
SQDQRSPPHWEKSLLLQEPTSRLAETETPRTKSDNKENPQQEGAKGAKPCVLSVGRPKGS
GLQSPEPRGASLSEPRLSQRQFSTPSAQKPFAHYQRHCRELEYIGAPLKSHPLRELKKSK
GSRRSLSNHLQRLSHQPARSAKKPYKCDECGKSFTWNSELKRHQRVHTG
Download sequence
Identical sequences Q3SZL2
ENSBTAP00000002117 NP_001030278.1.59421 NP_001030278.1.76553 ENSBTAP00000002117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]