SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001031734.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001031734.1.80155
Domain Number 1 Region: 150-241
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000373
Family N-acetyl transferase, NAT 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001031734.1.80155
Sequence length 263
Comment Acyl-CoA N-acyltransferases (NAT) superfamily protein [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MAFLCSSLPSSSSIAIFGDPNTDGSSRSYLSIPSLKLRFRPVAASSHICAPAIDKSTFVI
SESVSEDELWAAACLRVRTFNELNPSAYNIQDHRRYLAEREFEALKERTSGKREGFTRVA
CINATLPLSQLSSSFEDLCSACKFSDGIEDRVVVGSLDLNQCRWLPDEIAGTKPEGIGVD
FARAYLSNVCVAKELHRNGVGYKLIDKSKRVAGEWDNEAAKSLYMKSGFEQETAEPAWQA
RYLNRPQRLLLWLALPTSPIMSM
Download sequence
Identical sequences B9DG63
AT4G28030.2 NP_001031734.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]