SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001032519.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001032519.1.92137
Domain Number 1 Region: 66-231
Classification Level Classification E-value
Superfamily RUN domain-like 8.24e-54
Family RUN domain 0.000000026
Further Details:      
 
Domain Number 2 Region: 523-611
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000302
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.024
Further Details:      
 
Weak hits

Sequence:  NP_001032519.1.92137
Domain Number - Region: 271-318
Classification Level Classification E-value
Superfamily Prefoldin 0.00165
Family Prefoldin 0.016
Further Details:      
 
Domain Number - Region: 278-501
Classification Level Classification E-value
Superfamily Tropomyosin 0.0216
Family Tropomyosin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001032519.1.92137
Sequence length 620
Comment protein RUFY3 isoform 1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHED
PNYLMANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKK
TFLGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYM
KALINKKELLSEFYEPNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDSQVGVIDFSM
YLKDGNSSKGTEGDGQITAILDQKNYVEELNRHLNATVNNLQAKVDALEKSNTKLTEELA
VANNRIITLQEEMERVKEESSYILESNRKGPKQDRTAEGQALSEARKHLKEETQLRLDVE
KELEMQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVK
QKSELNSRLEEKTNQMAATIKQLEQRLRQAERSRQSAELDNRLFKQDFGDKINSLQLEVE
ELTRQRNQLELELKQEKERRLQNDRSIPGRGSQKSESKMDGKHKMQEENVKLKKPLEESH
RLQPHPMDEQDQLLLSEKPQLCQLCQEDGSLTKNVCKNCSGTFCDACSTNELPLPSSIKL
ERVCNPCHKHLMKQYSTSPS
Download sequence
Identical sequences gi|82697315|ref|NP_001032519.1| 9606.ENSP00000370394 ENSP00000370394 ENSP00000370394 ENSP00000420980 NP_001032519.1.87134 NP_001032519.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]