SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001032926.2.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001032926.2.86415
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-39
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 2 Region: 36-131
Classification Level Classification E-value
Superfamily C-type lectin-like 4.85e-36
Family Link domain 0.00000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001032926.2.86415
Sequence length 275
Comment tumor necrosis factor-inducible gene 6 protein precursor [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MIALIFFSALLWDEAQAWGFKDGVLHNSIWLERAAGVYHRESRSGKYQLTYAEAKAVCEY
EGGHLATYQQLEAARKIGFHVCAAGWMAKGRVGYPIVKAGANCGFGRTGIVDYGIRLNRS
ERWDAYCYNPNGKECGGVFTDSKHVFKSPGYPNEYENDQICYWHIRVKYGQRIHLQFLEF
DVEDDTACMADYLEIYDSYDDINGFVGRFCGDELPDDIISTGNVMTLKFLSDASVTAGGF
QIRYVTIDVPSKAGDGKNTTSQGKANFLSGKFGIM
Download sequence
Identical sequences Q155F6
NP_001032926.2.86415 9031.ENSGALP00000020364 ENSGALP00000020364 ENSGALP00000020364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]