SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001033144.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_001033144.1.76553
Domain Number - Region: 170-215
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0667
Family Rad50 coiled-coil Zn hook 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001033144.1.76553
Sequence length 234
Comment small kinetochore-associated protein [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MAAAEDVAHASDCRTTWPPTESAPHLLPPGRRKFPFETQAADAVGGTAVIAEHLLNQSDE
ACGQEQQAPGPQPCRLVTMTSVVKTVYTLQPSCVLSSGLPADAQTRATFKSQLPVKSKEV
DVSRPHSGASENDVTKIIKPRRENGQVKATDTSRRNLRKSYKPLSKQKSEEELKDKNQLL
EAVNKQLHQKLIETQGELKDLTQKVELLEKFQDNCLAILESKGLNPAAVTNFAR
Download sequence
Identical sequences Q2TA15
ENSBTAP00000043228 NP_001033144.1.59421 NP_001033144.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]