SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001034935.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_001034935.1.87134
Domain Number - Region: 16-22,73-97,142-150
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0578
Family Di-heme elbow motif 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001034935.1.87134
Sequence length 232
Comment izumo sperm-egg fusion protein 4 isoform 3 precursor [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MALLLCLVCLTAALAHGCLHCHSNFSKKFSFYRHHVNFKSWWVGDIPVSGALLTDWSDDT
MKELHLAIPAKITREKLDQVATAVYQMMDQLYQGKMYFPGYFPNELRNIFREQVHLIQNA
IIESRIDCQHRCGIFQYETISCNNCTDSHVACFGYNCESSAQWKSAVQGLLNYINNWHKQ
DTSMRPRSSAFSWPGTHRATPAFLVSPALRCLEPPHLANLTLEDAAECLKQH
Download sequence
Identical sequences Q1ZYL8
gi|89903023|ref|NP_001034935.1| NP_001034935.1.87134 NP_001034935.1.92137 ENSP00000378712 ENSP00000378712 9606.ENSP00000378712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]