SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001035101.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001035101.1.99540
Domain Number 1 Region: 271-518
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8e-60
Family Nuclear receptor ligand-binding domain 0.0000000056
Further Details:      
 
Domain Number 2 Region: 165-244
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.04e-26
Family Nuclear receptor 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001035101.1.99540
Sequence length 548
Comment estrogen receptor beta [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MSTYMHKEYSQLQPMQHILHGKADIKSSPSAINSSVPYSGTVPMDQSPMYTPSSYLDSRH
DYPSITFCSPSLINYNVPGSDSESSVLRQTVSPGLLWTSPDHMSPVTLHCQSSLLYTEAP
TSPWFEAKSEEHILPLSRESLKRKSMGSECANNVGSNPGSKRDTHFCAVCSDYASGYHYG
VWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCFEVGMMKCGTRRE
RCGYRIVRHRRHSDDQMHCLAKNKKLTDNIQRVKEISASSLGPEQFVLIISDAEPPNVML
MNRLCKPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLYDQVRLLESCWLEILMM
GLMWRSIDHPGKLLFAPDLTLDRDEGKCVEGILEIFDMLLATTSRLRELKLQHREFLCLK
VMILLNSHVFPLTSSEEESESSRKLHHPLNTVTDALVWVIAKSGIPFRQQSTRLANLLML
LSHVRHASNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTLRDHRKSTLAISNYSSKAESEA
RDAGQPTQ
Download sequence
Identical sequences Q25C13
NP_001035101.1.99540 gi|89331176|gb|BAE81789| gi|90968574|ref|NP_001035101|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]