SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001035340.2.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001035340.2.45394
Domain Number 1 Region: 35-149
Classification Level Classification E-value
Superfamily POZ domain 7.26e-31
Family BTB/POZ domain 0.00072
Further Details:      
 
Domain Number 2 Region: 304-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000404
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Weak hits

Sequence:  NP_001035340.2.45394
Domain Number - Region: 333-393
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0662
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001035340.2.45394
Sequence length 459
Comment zinc finger and BTB domain-containing protein 8A [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MEMVCESGTCRPYRSAGDAGHLPVNKWTSADMSAIHQSCLLKQLDQQRKQELFCDCSVLV
EGQIFHAHRNVLYGSSGYFRMLLTQGAKDTVDSVSASFDVFSPDIFTIILDFIYSGQLEL
NSSNVIEVMSAASYLQMNDVISYCKAFIKSFLEISTKEDDENRYLCLSENSSLQDRREST
IEPSNMCDVSMSSQSRLWDEEQEDDQPQEDFGGTSPQPSGLQHNSPAQSSLEEQYSSVLP
ERRRRGSRKRTASSRLVAEDTSLIDLQGVVSHCSQKADELYANLPSIVGVVGMFNKDATP
SMRYKCPFCTHTVKRKADLKRHLRCHTGERPYPCQACSKRFTRLEHLRSHFETIHQARKL
VCRKCKRHVTEVSGRVVSEGTRKYRLCDVCIQESGYNDLITDETDGNEDKEGLLLGVDED
MSENRQITWVMDDDDLAEDSGADLIIQEVDDSDEEASGK
Download sequence
Identical sequences F1RE12
NP_001035340.2.45394 ENSDARP00000112298 ENSDARP00000112298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]