SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001035418.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001035418.1.45394
Domain Number 1 Region: 225-491
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.71e-83
Family Protein kinases, catalytic subunit 0.00000000162
Further Details:      
 
Domain Number 2 Region: 115-257
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-38
Family SH2 domain 0.00000844
Further Details:      
 
Domain Number 3 Region: 56-165
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-22
Family SH3-domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001035418.1.45394
Sequence length 503
Comment tyrosine-protein kinase Lck isoform 2 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MGNCGSFDPDDEFSYHPDEWCDQCNCPKPPVSQNFDPLIPYPSQYTPPPSSPLPENLVVA
IYKYDPAHSDDLGFEKGEKMKILDCDDPEWYMAESLFTGQRGYIPKNFVAKLNSMETEPW
FYKNLSRNDAMRQLLAPGNTQGSFLIRESETQPGSFSISVRDLDPMQGDIIKHYRIRNMD
AGGFYITNKISFNSLSELVKHYSREADGLCTRLVKPCQTRAPQKPWWQDEWEVPRESLKL
ERRLGQGQFGEVWMGLYNNNRQVAIKSLKPGTMSISAFLAEANLMKSLQHPRLVRLFAVV
TQEPIYIITEYMENGSLVDFLKTPEGSDIPINTLIDMAAQVAEGMAYVEQKNYIHRDLRA
ANILVSHELTCKIADFGLARLIENNEYTAREGAKFPIKWTAPEAINYGTFSIKSDVWSFG
VLLTEIVTYGRIPYPGMTNPEVIANLERGYRMPCPDNCPEALYNVMKHCWTENPDNRPTF
EFLRSVLEDFFTATEGQYQEQPC
Download sequence
Identical sequences Q1RLY5
ENSDARP00000076792 ENSDARP00000096251 ENSDARP00000110287 ENSDARP00000124901 ENSDARP00000076792 NP_001035418.1.45394 7955.ENSDARP00000076792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]