SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001036819.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001036819.1.92730
Domain Number 1 Region: 210-450
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-70
Family Nuclear receptor ligand-binding domain 0.000000000347
Further Details:      
 
Domain Number 2 Region: 7-92
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-31
Family Nuclear receptor 0.0000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001036819.1.92730
Sequence length 459
Comment nuclear receptor ROR-beta isoform 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRN
RCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQSGEAEALAR
VYSSSISNGLSNLNTETGGTYANGHVIDLPKSEGYYSIDSGQPSPDQSGLDMTGIKQIKQ
EPIYDLTSVPNLFTYSSFNNGQLAPGITMSEIDRIAQNIIKSHLETCQYTMEELHQLAWQ
THTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQNDQILLLKSGCL
EVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIA
LFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVC
NLHGEKLQVFKQSHPDIVNTLFPPLYKELFNPDCAAVCK
Download sequence
Identical sequences NP_001036819.1.92730 XP_021049016.1.100879 ENSMUSP00000108451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]