SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001037868.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001037868.1.99540
Domain Number 1 Region: 61-106
Classification Level Classification E-value
Superfamily LysM domain 0.000000235
Family LysM domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001037868.1.99540
Sequence length 207
Comment lysM and putative peptidoglycan-binding domain-containing protein 2 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MADLSPVLQPHREGGSRYGYTMFPGLECESEAELSLSLARTKTRSYGSTASVAAPLSERY
IEHRLSPSDTLQGIALKYGVTMEQIKRANKLFSTDCIFLRKSLNIPVISKKGSLFNGLGS
LDSPENETQDNCNSPTKEPALAEAHTVSIPSSAKTNQPIVRSDEELSAKDFLQRLDLQIK
RSTQAAQRLKEEDLRHDDSYATCSYQH
Download sequence
Identical sequences Q3B7I8
ENSXETP00000044860 gi|110645648|gb|AAI18886| gi|113205522|ref|NP_001037868| gi|114150021|sp|Q3B7I8| gi|77748410|gb|AAI07590| NP_001037868.1.99540 ENSXETP00000044860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]