SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001038715.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001038715.1.45394
Domain Number 1 Region: 5-278
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.38e-72
Family BAR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 397-574
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.000000658
Further Details:      
 
Domain Number 3 Region: 708-763
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000919
Family SH3-domain 0.00018
Further Details:      
 
Domain Number 4 Region: 264-368
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000079
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001038715.1.45394
Sequence length 764
Comment rho GTPase-activating protein 10 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MGLHPLEFSECYLDSPAFRDKIKAHEAELEKTGRFIKELYKDGKNLINATKQLSLAQKKF
AQCLGEFKFEYIGDAKTDDEKCIDESLQEFSLFLRNLEEQRDLMMRNITETLMKPLENFR
KEHLGSAKAERKKYEKETEKYYSSLEKLLNMSAKKKEPQLQEADVSVELMRQHFQETSLE
YVCKLQEIQERKKFECVEPMLAFFQTVFTFYHQGYELAKDFDHYKKALQINIQNTRNRFE
GTRSEVFELMKRIKESPQDYRQTSPISSEGYLYVQEKRPPPFGSSWVKRYSTFVKEQKIL
HMKTFDQRSGGKLGETESVTLKSCVRKTTDALDRRFCLDIEITDRPGTVLTVQALSEDDH
KFWMHAMGGKEPMQCLNRTHSRERGIDAQLDDVGISFVKNSINAIEARGINDQGLYRVVG
VSSKVQKLLSLMIDEKSSDIDLSANEDWDVKTITSALKLYLRSLPEPLMTYELYKEFIVP
AKSASPESRVQAIHCLVHKLPEKNRLVLSLVTKHLANVAANSKQNLMTVANLGVVFGPTL
MRPQEETVAAIMDLKFQNIVVEILIEQHEKIFGDAPSSSPSLATTPLSAPTRQSKRLSRQ
TRPLAVYNPQVLDIQTVSPSSESAGLCNDETSVGSNESVSSQSSNASGTPPEKSKNHHTT
ISTSLQEGTGICTATASWMNSASPASLTPVKHGSVRTEKNKPEESVTLMKAKAVYPCEAE
HDSELSFQVGAIFHDVTLSREPGWLEGVLEGKRGLIPENYVEIL
Download sequence
Identical sequences Q1JPR9
ENSDARP00000100587 ENSDARP00000100587 NP_001038715.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]