SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001039531.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001039531.1.76553
Domain Number 1 Region: 57-393
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.56e-80
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00002
Further Details:      
 
Domain Number 2 Region: 407-500
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.01e-19
Family Anticodon-binding domain of Class II aaRS 0.005
Further Details:      
 
Domain Number 3 Region: 4-58
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00000000000286
Family a tRNA synthase domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001039531.1.76553
Sequence length 509
Comment histidine--tRNA ligase, cytoplasmic [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MADRAALEDLVRVQGERVRGLKQQKASAEQIEEEVAKLLKLKAQLGPDEGKPKFVLKTPK
GTRDYSPRQMAVREKVFDVIISCFKRHGAEVIDTPVFELKETLTGKYGEDSKLIYDLKDQ
GGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAG
QFDPMLPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVPDSKFRTICSSVDK
LDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLG
DLKLLFEYLTLFGIADKISFDLSLARGLDYYTGVIYEAVLLQPPARAGEEPLGVGSVAAG
GRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKVRTTETQVLVASAQKKL
LEERLKLISELWDAGIKAELLYKKNPKLLNQLQYCEETGIPLVAIIGEQELKDGVIKLRS
VASREEVDVRREDLVEEIKRRTSQPLCIC
Download sequence
Identical sequences Q2KI84
ENSBTAP00000025094 NP_001039531.1.59421 NP_001039531.1.76553 XP_010848672.1.44457 XP_019820620.1.53367 ENSBTAP00000025094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]