SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001039642.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001039642.1.59421
Domain Number 1 Region: 72-340
Classification Level Classification E-value
Superfamily L domain-like 4e-51
Family Ngr ectodomain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001039642.1.59421
Sequence length 346
Comment leucine-rich alpha-2-glycoprotein precursor [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MSSQNPERKQSLVGWDSHLSRIFLLLLFVVSAQGLTPNPEACLVFSSVNGSSISCQPPAQ
IPHSLPADTIFLAVEFFNLTQLPADFLQGVPNLQELHLSSNRLEDFSPKFLLPVPQLKVL
DLTRNSLTGLFPGFFRVSAALCTLVLKGNQLKFLEASWLHGLKALRHLDLSENQLHSLPP
GLLENFTDLLTLDLSNNQLQTLPPDLLRGPLNLERLHLEGNRLQVLGEGLLAPQPKLRYL
FLNDNRLASVAAGAFRGLQKLDMLDLSNNLLTTVPTGLWTSLGKAARNLKDGFDISNNPW
ICDQNLADLYRWLVANENKMFFRNHTRCAGPEALKGQTLLAAAESH
Download sequence
Identical sequences Q2KIF2
9913.ENSBTAP00000003618 NP_001039642.1.59421 NP_001039642.1.76553 ENSBTAP00000003618 ENSBTAP00000003618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]